English Word Reference Free

wow

Definition, pronunciation, etymology, and usage for the English word. Free spelling reference powered by Wiktionary.

Letters

3 characters

Language

English

word origin

Source

Wiktionary

open dictionary

Access

Free

no sign-up needed

Detailed reference entry for the English word "wow", 3-letters, with pronunciation in International Phonetic Alphabet notation, etymology traced through Germanic and Romance roots where applicable, common misspelling variants catalogued from Hunspell error dictionaries, and usage frequency ranked against the top 100,000 English words in the Wordfreq corpus. PlainSpell covers English, Spanish, Portuguese, French, and German spelling with confusable-pair detection that highlights visually and phonetically similar words. This entry for "wow" includes synonyms, antonyms, homophones, and cross-language translation pointers sourced from Wiktionary via the kaikki.org extract. Whether you are verifying the correct spelling of "wow" for academic writing, checking homophone confusion, or exploring etymological origins, this page provides a citation-backed, free reference that requires no sign-up.

wow is anEnglishintj. It means: An indication of excitement, surprise, astonishment, or pleasure. Pronounced /waʊ/. It ranks #1,178 in English word frequency. Often confused with Wu and wt.

Key facts for wow
PropertyValue
Headwordwow
LanguageEnglish
Part of speechIntj
IPA/waʊ/
Letters3
Frequency rank#1,178
Misspellings tracked0
Confusable pairs20
SourceWiktionary (kaikki.org)

Frequency rank visualization

Position of wow in English word frequency (lower rank = more common)

Source: Wordfreq corpus

Spelling & Dictionary Insight

The English entry for wow is 3 letters long, classified as anintj, and transcribed in the International Phonetic Alphabet as /waʊ/. Corpus data places it at rank #1,178 in overall English word frequency, indicating it appears regularly in written and spoken text.Wiktionary records 3 distinct senses for this headword, so context determines which meaning a reader should apply.

No frequent misspelling variants are recorded for wow in our index, suggesting the orthography either follows predictable English patterns or the word is uncommon enough that typo corpora lack signal.It also participates in 20 confusable-pair relationships, "Wu", "wt", "WS", and more, where similar look or sound leads writers to substitute one word for another in context.

Etymologically, the entry records: Attested since the 16th century; borrowed from Scots wow; ultimately a natural exclamation. Root origin matters for spelling because borrowed morphemes (Greek, Latin, Old French, Old English) carry their source-language orthographic conventions into modern English, which is why historical etymology is often the cleanest predictor of whether a cluster like "-ough", "-eau", or "-tion" will appear. For readers arriving here from a spelling check, the authoritative guidance is: the correct English form is wow, spelled W-O-W, and any other sequence of those letters, regardless of how natural it feels, is a misspelling in standard orthography.

Definition

  1. 1
    An indication of excitement, surprise, astonishment, or pleasure.
  2. 2
    An expression of amazement, awe, or admiration.
  3. 3
    Used sarcastically to express disapproval of something.

Etymology

Attested since the 16th century; borrowed from Scots wow; ultimately a natural exclamation.

Synonyms

adzooksaycarambamirabile dictuchihuahuabegorrableeding heckbleeding Norabless my heartbless my soulbless usbligeblimeybloody hellbloody Norablow meblow me backwardsblow me downblow me overblow me pinkblow me tightblow me upblow my buttonsbutter my butt and call me a biscuitby all that is holyby Allahby crackyby Georgeby Godby gollyby gumby gummyby jingoby Joveby juckiesby Jupiterby thunderby the living jingobyrladyChristChrist aliveChrist almightyChrist on a bikeChrist on a crackerChrist on a raftChrist on a stickcoocorcor blimeycor lummycowabungacrikeycriminycripescrivvenschuffing helldear Goddear medearie medeary medear Lorddiggetyeepegadegadsermahgerdfancy thatflaming Noraflipping heckflipping Norafuarkfuck mefucking hellfucking Noragad soGadsbodikinsgadsbudgadzooksgawgeegee whizgee willikersgeeminygeezgeez Louisegeshmakget out of townglory beGod AlmightyGod in heavenGod's teethgood gollygollygolly gee willikersgolly goshgood Godgood graciousgood gravygood griefgood heavensgood Lordgoodnessgoodness graciousgoodness gracious megoodness megoogly-mooglygorblimeyGordon Bennettgoshgosh all hemlockgraciousgramercygreat balls of firegreat Caesargreat Caesar's ghostgreat googly mooglygreat Scottgyatthallohelloheavensheavens aboveheavens to Betsyheavens to Murgatroydhell's bellsheyheydayhold upholy bucketsholy cannoliholy cowholy crapholy crap on a crackerholy cricketholy cricketsholy crudholy dignityholy doodleholy fuckholy fuck knucklesholy fudgeholy guacamoleholy Hannahholy hellholy kamoleyholy kamolyholy macaroniholy mackerelholy magnumholy moleyholy molyholy manholy MosesHoly MotherHoly Mother of Godholy ravioliholy shitholy stromboliholy smokeholy Toledohooly doolyhot damnI'll beI'll be a dirty bird!I'll be a monkey's uncleI'll be a son of a bitchI'll be a son of a gunI'll be blowedI'll be boundI'll be buggeredI'll be damnedI'll be dangedI'll be darnedI'll be dashedI'll be dippedI'll be dipped in shitI'll be hangedI'll be hornswoggledI'll be jiggeredI'll be shotimagine thatI'm blowedI sayJaney MackJaysusJeebusjeepersjeepers creepersjeezjeez Louisejeezy peepsJerusalem cricketsJesum CrowJesusJesus ChristJesus fucking ChristJesus H. ChristMary and JosephJesus MurphyJiminy CricketjingsjinkiesJudas Priestjumping Jehoshaphatjumping Jesusknock me down with a featherknock me over with a featherland sakeslaukslawkslawks a-mercylawlleapin' lizardsLordLord be praisedLord love a ducklordymama miamamma miaman alivemercy sakesMother of Godmymy consciencemy giddy auntmy heavensmy sainted auntmy sainted unclemy Godmy goodnessmy goshmy Lordmy mymy wordno wayO geminiods bodikinodsfishodzookensohoh em geeohmigodoh myoh my daysoh my Godoh my Goddessoh my goodnessoh my goodness graciousoh my goshoh my helloh my heckoh my fuckoh my lifeoh my Lordoh my starsoh my wordoiOMGomigodomigoshpeas and ricepleasepraise the Lordrahruddy hellruddy Norasacré bleusakes alive'sblood'sdeathshart'sheartsheeshshit fire and save matchesshitting Norashiver my timbersshut my mouthshut the front doorslap my ass and call me Judyslap my ass and call me Sallysnakes alivesodding hellson of a gunstone mestone the crowsstrewthstrike me pink'struthsuffering Sapphosuffering succotashsweet Grandma on stiltssweet Jesussweet Marysweet mother of Godsweet mother of JesuswaowwellI neverwhatwhat do you knowwhoawhoahwowwoweewowzersye godsyikesyikes bikesyou don't sayyowzahzoikszoinksZOMGZOMFGzooterkinszoundzoundszowie

Antonyms

This word in other languages

Frequency rank: #1,178 in English

Frequently Asked Questions

How do you spell "wow"?
"wow" is spelled W-O-W. The IPA pronunciation is /waʊ/.
What does "wow" mean?
As an intj, "wow" means: An indication of excitement, surprise, astonishment, or pleasure.
What words are commonly confused with "wow"?
"wow" is commonly confused with "Wu", "wt", "WS". These words look or sound similar but have different meanings. PlainSpell provides detailed comparisons for each pair.
How do you pronounce "wow"?
The IPA (International Phonetic Alphabet) transcription for "wow" is /waʊ/. Click the speaker icon on the pronunciation badge above to hear it spoken aloud where audio is available.
What is the origin of the word "wow"?
Attested since the 16th century; borrowed from Scots wow; ultimately a natural exclamation. See the full etymology section above for more details.
Is PlainSpell free to use?
Yes, PlainSpell is a completely free word reference. You can look up definitions, pronunciations, confusable pairs, homophones, and spelling corrections across 5 languages without any sign-up or subscription.

Nearby English words

Other entries that begin with the letter W in our English index:

Explore PlainSpell

Data Source: Wiktionary (via kaikki.org), licensed under CC BY-SA & GFDL. Frequency data from Wordfreq. Misspellings derived from Hunspell dictionaries.