whore

[…]

/[…]/ noun

The verdict

“whore” is uncommon German (outside the top frequency list), classed as a noun. The kind of spelling people second-guess.

Unranked
below top-frequency German
5
letters

According to Wiktionary data (CC BY-SA, analyzed May 6, 2026) - für eine Prostituierte; Hure

Key facts for whore
PropertyValue
Headwordwhore
LanguageGerman
Part of speechNoun
IPA[…]
Letters5
Misspellings tracked0
Confusable pairs0
SourceWiktionary (kaikki.org)

Where “whore” sits in German frequency

whore falls outside the top-100,000 ranked German words, the long-tail zone of technical, archaic, or low-frequency vocabulary, exactly where readers second-guess spellings most.

Beyond rank #100,000. Source: FrequencyWords open word-frequency list.

Rare enough to double-check

whore is uncommon German outside the top frequency list, classed as anoun, transcribed […]. Rarity is why readers land here mid-draft. Gloss: "für eine Prostituierte; Hure".

No generated misspelling entries exist for whore in our index, since its letter sequence doesn't invite the usual edit-distance slips. This headword has no recorded confusable partner, a sign it's visually distinctive enough not to be mixed up with another word.

No explicit etymology string is stored for this entry, leaving phoneme-to-grapheme mapping as the best guide to its spelling rather than a borrowing history. The correct German form is whore, spelled W-H-O-R-E.

Definition

  1. 1
    für eine Prostituierte; Hure

Synonyms

harlotprostitutestrumpetcourtesanbawdpunkdrabdemirepstreet-walkernight-walkercyprianwoman of the townwoman of ill-fame

Definitions, pronunciation, and etymology for this entry are drawn from Wiktionary via the kaikki.org structured extract (CC BY-SA). See the methodology for how each field is sourced and updated.

Frequently Asked Questions

How do you spell "whore"?
"whore" is spelled W-H-O-R-E. The IPA pronunciation is […].
What does "whore" mean?
As a noun, "whore" means: für eine Prostituierte; Hure
How do you pronounce "whore"?
The IPA (International Phonetic Alphabet) transcription for "whore" is […]. Click the speaker icon on the pronunciation badge above to hear it spoken aloud where audio is available.
What language does "whore" come from?
"whore" is a German word. You can look up definitions, pronunciations, and spelling data for this and other words across English, Spanish, Portuguese, French, and German on PlainSpell.
Is PlainSpell free to use?
Yes, PlainSpell is a completely free word reference. You can look up definitions, pronunciations, confusable pairs, homophones, and spelling corrections across 5 languages without any sign-up or subscription.

Using “whore”

The practical upshot for anyone who landed here from a spell-check.

  • The one correct German spelling is W-H-O-R-E - every other letter order is a misspelling in standard orthography.
  • Say it as […] (IPA); tap the speaker on the pronunciation badge to hear it where audio exists.
  • Browse more German words and confusable pairs in the same reference. German words
Data Source

Wiktionary (via kaikki.org), licensed under CC BY-SA & GFDL. Word ordering uses an open word-frequency list; misspelling variants are generated by edit-distance from the correct headword.

Source: Wiktionary (via kaikki.org) Structured Wiktionary extract

Source: FrequencyWords open word-frequency list